PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00124709001
Common NameGSBRNA2T00124709001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 393aa    MW: 44403.3 Da    PI: 9.6553
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00124709001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.32.7e-3167120255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          prlrWtpeLH +F++ave+LGG+++AtPk +l+lm+vkgL++ hvkSHLQ+YR+
  GSBRNA2T00124709001  67 PRLRWTPELHICFLQAVERLGGPDRATPKLVLQLMNVKGLSIGHVKSHLQMYRS 120
                          8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-2963121IPR009057Homeodomain-like
PROSITE profilePS5129413.47563123IPR017930Myb domain
SuperFamilySSF466891.76E-1564121IPR009057Homeodomain-like
TIGRFAMsTIGR015575.3E-2467122IPR006447Myb domain, plants
PfamPF002494.1E-968119IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MRSSSQSSEN SKKTDNKDEE EDEEERSADQ SPSKNSYLEE NGSHHHNNDQ IKKSGGSVRP  60
YNRSKTPRLR WTPELHICFL QAVERLGGPD RATPKLVLQL MNVKGLSIGH VKSHLQMYRS  120
KKIDDTNQGW FRDQRFSFEH GAGYTYNLRQ LPMLQSFDQS PTSLGYGGGS WTGHRQHVYH  180
SPWRGLTARD NTRTRQTLFG SQPGERFHGV SNSILDDKNS TVWFRINSHE AAHANNGVGE  240
AVPRMHRSFL EGMKTFNKSW GQSLASNPNS WTASKPQSHI AATLSSNQRD NPLVAEKMEN  300
VLKKKRLLLS DDCNNSDKDL DLSLSFKVPR SHNNLGDCLL EEEKEHADSK GLSLSLYSSS  360
FAKLGQIIRK EDQNYHKKRK CSVLASPLDL TL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00124709001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009133426.10.0PREDICTED: uncharacterized protein LOC103857923
TrEMBLA0A078F3G40.0A0A078F3G4_BRANA; BnaA03g18990D protein
STRINGBra000180.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM93592136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.10.0G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]